DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Gucy1b1

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_036901.2 Gene:Gucy1b1 / 25202 RGDID:2769 Length:619 Species:Rattus norvegicus


Alignment Length:297 Identity:74/297 - (24%)
Similarity:132/297 - (44%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GSSVYVLGMVVSIIYIGYAFYMQYLNDQVSFYL--LASYAIYL-------FTLNLIFSFFTIIRD 221
            |:.:..|.:...:||:..|..:.:|.......|  |....:||       .|.:|:........:
  Rat   298 GAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREE 362

  Fly   222 YGLRR---AILSRYQLVYQNIVYQLVMKKENGLLESILPRKMIRTLQEEICSRIEDQDKNFTPSK 283
            |.|.:   .:..|.||..:.:..:  .||.:.||.|:||..:...|:.          |...|:|
  Rat   363 YKLTQELEILTDRLQLTLRALEDE--KKKTDTLLYSVLPPSVANELRH----------KRPVPAK 415

  Fly   284 AGLRKLFLEPYPNVSILVADMVNYTHLTTTLE----APQLVEILHDLFVNFDLAANRNR---AMR 341
            .         |.||:||.:.:|.:....:...    |.::|.:|:||:..||...:..:   ..:
  Rat   416 R---------YDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYK 471

  Fly   342 IKFLGDSYNCVAGIPNYFPAHASCCVDQALEMIHITQGVSSRRELDINLRIGVHSGEVFAGIIGH 406
            ::.:||.|..|:|:|.....||......||:|:.|...|....| .:.:.||:|:|||..|:||.
  Rat   472 VETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGE-SVQITIGIHTGEVVTGVIGQ 535

  Fly   407 TKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSML 443
            ...::.::...|::|:|.|::|..|.::||:.|...|
  Rat   536 RMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 55/200 (28%)
Nucleotidyl_cyc_III 292..445 CDD:299850 46/159 (29%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Gucy1b1NP_036901.2 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 24/109 (22%)
CYCc 385..584 CDD:214485 57/210 (27%)
Guanylate_cyc 412..605 CDD:278633 48/171 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.