DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Gucy2f

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_001007577.1 Gene:Gucy2f / 245650 MGIID:105119 Length:1108 Species:Mus musculus


Alignment Length:343 Identity:81/343 - (23%)
Similarity:158/343 - (46%) Gaps:70/343 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 TLNLIFSFF--------TIIRDYGLRRAILSRYQLVYQNIV------YQLVMKKENGLLESILPR 258
            |.:.||:.|        |.|.|..||  :|.:|....::::      .::..:|...||..:||.
Mouse   801 TFDEIFNQFKTFNKGKKTNIIDSMLR--MLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPL 863

  Fly   259 KMIRTLQEEICSRIEDQDKNFTPSKAGLRKLFLEP--YPNVSILVADMVNYTHLTTTLEAPQLVE 321
            .:..:|::. |:                    :||  :..|::..:|:|.:|.::...|..::|:
Mouse   864 SVAESLKKG-CT--------------------VEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVD 907

  Fly   322 ILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAGIPNYFPA-HASCCVDQALEMIHITQGVSSRR- 384
            :|:||:..||.....:...:::.:||:|...:|:|....: ||:...:.:|:::........|. 
Mouse   908 LLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHM 972

  Fly   385 -ELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRT---LSMLDE 445
             |:.:.:|||:|||.|.||::|.|..::.::...|:..:|:||:|||..:|||..|   |..|.|
Mouse   973 PEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQTLSE 1037

  Fly   446 HY---------IFREGTEAAKNDPILQQAGIRTFLVSNRLPDAV-EPGELDDELSSASINSCRLS 500
            .|         :..:|||..     ....|.:.|.....:|..| :.|::...|..|.|.:.:  
Mouse  1038 GYEVELRGRTELKGKGTEET-----FWLVGKKGFTKPLPVPPPVGKDGQVGHGLQPAEIAAFQ-- 1095

  Fly   501 YGGYYEEIQIKAQREIMK 518
                    :.||:|::::
Mouse  1096 --------RRKAERQLVR 1105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 55/214 (26%)
Nucleotidyl_cyc_III 292..445 CDD:299850 47/160 (29%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Gucy2fNP_001007577.1 PBP1_sensory_GC_DEF-like 54..435 CDD:380594
PKc_like 545..815 CDD:419665 4/13 (31%)
HNOBA <824..869 CDD:400168 9/46 (20%)
CYCc 848..1040 CDD:214485 55/212 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.