DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Gucy1b2

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:XP_011243363.2 Gene:Gucy1b2 / 239134 MGIID:2660873 Length:829 Species:Mus musculus


Alignment Length:323 Identity:75/323 - (23%)
Similarity:139/323 - (43%) Gaps:70/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 ILSRYQLVYQNIVYQLVMKKE----------------NGLLESILPRKMIRTLQEEICSRIEDQD 276
            :|::.:|....:..||..|||                ..||.::||..:...|:|.         
Mouse   514 LLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEG--------- 569

  Fly   277 KNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMR 341
                      :|:....:...:||.:|:|.:|::....|..|:|.:|:.::..||...|.:...:
Mouse   570 ----------KKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYK 624

  Fly   342 IKFLGDSYNCVAGIPNYFPAHASCCVDQALEMIHITQGVSSRRELD------INLRIGVHSGEVF 400
            ::.:||:|..|.|:|....:||....:.||.|     .:|::..::      |.:|:|:|:|.|.
Mouse   625 VETIGDAYMVVGGVPVPVESHAQRVANFALGM-----RISAKEVMNPVTGEPIQIRVGIHTGPVL 684

  Fly   401 AGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDEHYIFREGTEAAKNDPI-LQQ 464
            ||::|....::.::...|:..:|:||.|||..||:|......|:     .:|.|......| ::.
Mouse   685 AGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALE-----NKGFEIVTRGEIEVKG 744

  Fly   465 AGIRT--FLVSNRLPDAVE----PGELDDELSSASINSCRLSYGGYYEEIQIKAQREIMKEVD 521
            .|..|  ||:.|.....||    |..|.|...:::..:            |:|..|.::..:|
Mouse   745 KGKMTTYFLIRNLNATEVEIMGRPSALADGKEASTPRN------------QVKKPRAVLSNMD 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 51/203 (25%)
Nucleotidyl_cyc_III 292..445 CDD:299850 44/158 (28%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Gucy1b2XP_011243363.2 HNOB 115..276 CDD:400167
HNOBA 380..566 CDD:400168 11/51 (22%)
Guanylate_cyc 572..754 CDD:306677 50/191 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.