DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and gcy-9

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_509897.3 Gene:gcy-9 / 191645 WormBaseID:WBGene00001536 Length:1081 Species:Caenorhabditis elegans


Alignment Length:283 Identity:81/283 - (28%)
Similarity:122/283 - (43%) Gaps:81/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 EEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRP-HDQLYYENFSKVAVMFASIENF---NADT 867
            |||.:|.|..|.|       :||..:|:..|:.:| ..|||    |...|:|:.|..|   ::.:
 Worm   861 EEAQKQADRLLNS-------MLPKSIAEDLKIGKPVLPQLY----SCATVLFSDIRGFTRISSTS 914

  Fly   868 AGLRI---LHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVACGLETDHYTDFSIDIPVKQPEAD 929
            ..|::   |:::...||.::..:.. ||:|.|   |..||:..|:.|::                
 Worm   915 TPLQVVTFLNDMFSGFDAIIAKHDA-YKVETI---GDAYMIVSGVPTEN---------------- 959

  Fly   930 SEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQ-VQDVAVLVMTEFALDLLRIMHDIRYNYVFSE 993
                 |:|                      :|| :.||| |.|..|..           |:..:.
 Worm   960 -----GNS----------------------HAQNIADVA-LKMRAFIC-----------NFKLAH 985

  Fly   994 YDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSSTGLLDNIQVTRHTAKVLRQF 1058
            ....|. .::||...|.|.||||||:.|.|.::|.|||.||||.|||:.:.||::.....:|..|
 Worm   986 RPEELM-MVRIGFHSGPVAAGVVGLAAPRYCLFGDTVNTASRMESTGVANKIQISEGAYNLLHCF 1049

  Fly  1059 --NIRCNYRGHTEVKGVGKVPTY 1079
              ..:...||..||||.|:..||
 Worm  1050 FPQFQMVERGKIEVKGKGECLTY 1072

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 66/249 (27%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 68/244 (28%)
gcy-9NP_509897.3 Periplasmic_Binding_Protein_Type_1 66..416 CDD:299141
ANF_receptor 69..404 CDD:279440
PKc_like 550..820 CDD:304357
HNOBA <837..883 CDD:285003 10/28 (36%)
CYCc 862..1054 CDD:214485 71/262 (27%)
Guanylate_cyc 889..1076 CDD:278633 69/248 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.