DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and gcy-5

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_496219.1 Gene:gcy-5 / 191643 WormBaseID:WBGene00001532 Length:1122 Species:Caenorhabditis elegans


Alignment Length:293 Identity:76/293 - (25%)
Similarity:144/293 - (49%) Gaps:47/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NLIFSFFTIIRDYGLRRAILSRYQLVYQNIVYQLVMKKENG--LLESILPRKMIRTLQEEICSRI 272
            ||:...|.::.:|      .|..::..:....:|.::|:..  ||..:||:::...|        
 Worm   823 NLMDHVFNMLEEY------TSTLEVDIEERTKELTLEKKKADILLSRMLPKQVAERL-------- 873

  Fly   273 EDQDKNFTPSKAGLRKLFLEP--YPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAAN 335
                      |||..   :||  :..|::|.:|:|.:|.|.......|:|.:|:||:.|||....
 Worm   874 ----------KAGQT---VEPEGFDTVTVLFSDVVKFTQLAAKCSPFQVVNLLNDLYSNFDTIIE 925

  Fly   336 RNRAMRIKFLGDSYNCVAGIP--NYFPAHASCCVDQALEMIHITQG--VSSRRELDINLRIGVHS 396
            .:...:::.:||.|.||:|:|  |.: ||....||.:|:.:...:.  |.......:.||||::|
 Worm   926 EHGVYKVESIGDGYLCVSGLPTKNGY-AHIKQIVDMSLKFMDYCKSFKVPHLPREKVELRIGINS 989

  Fly   397 GEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDEHYIFREGTEAAKNDPI 461
            |...||::|.:..::.::...|:..:|:||:|.|.::|:|:...|:|.:||..:..| :::.:.|
 Worm   990 GPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSMIHMSEAAHSLLTDHYPHQYET-SSRGEVI 1053

  Fly   462 LQQAGI-RTFLVSNRLPDAVEPGELDDELSSAS 493
            ::..|: .||.|.         |:.|.:..|.|
 Worm  1054 IKGKGVMETFWVL---------GKTDSDTKSLS 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 59/203 (29%)
Nucleotidyl_cyc_III 292..445 CDD:299850 49/158 (31%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
gcy-5NP_496219.1 PBP1_NPR_GC_like 30..440 CDD:107347
ANF_receptor 49..426 CDD:279440
PK_GC 546..816 CDD:270894
HNOBA <830..873 CDD:285003 8/48 (17%)
CYCc 852..1042 CDD:214485 60/211 (28%)
Guanylate_cyc 879..1067 CDD:278633 57/198 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.