DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and gcy-4

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_496218.2 Gene:gcy-4 / 191642 WormBaseID:WBGene00001531 Length:1136 Species:Caenorhabditis elegans


Alignment Length:352 Identity:84/352 - (23%)
Similarity:161/352 - (45%) Gaps:87/352 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NLIFSFFTIIRDY--------GLRRAILSRYQLVYQNIVYQLVMKKENGLLESILPRKMIRTLQE 266
            ||:...|:::.:|        |.|...|:            |..||.:.||..:||:::...|  
 Worm   826 NLMDHVFSMLEEYTSSLEVEVGERTKELT------------LEKKKSDILLGRMLPKQVAERL-- 876

  Fly   267 EICSRIEDQDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFD 331
                            ||| :.:..|.:..|::..:|:|.:|.|.:.....|:|.:|:|:|.|||
 Worm   877 ----------------KAG-QAVEPESFDLVTVFFSDLVKFTDLASKCSPFQVVNLLNDVFSNFD 924

  Fly   332 LAANRNRAMRIKFLGDSYNCVAGIPNYFPAHASCCVDQALEMIHITQGVS--------------S 382
            ....::...:::.:||.:.||:|:||          ...:|.|....|:|              .
 Worm   925 SIIEKHDVYKVESIGDGFLCVSGLPN----------RNGMEHIRQIVGMSLCFMEFCRNFRIPHL 979

  Fly   383 RRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDEHY 447
            .|| .:.||:|::||...||::|.:..::.::...|:..:|:||:|.|.::|:|:...|:|..:|
 Worm   980 PRE-RVELRVGINSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSMIHMSEAAHSLLVNNY 1043

  Fly   448 IFREGTEAAKNDPILQQAGI-RTF------LVSNRLPDAV-----EPGEL----DDELSSASINS 496
            .::..|. ::.:.|::..|: .|:      .:||:....:     :|.::    |.||::.|..|
 Worm  1044 PYQFETN-SRGEVIIKGKGVMETYWLLGKMSLSNQSTPPITKVNHKPRKIASFTDSELTNYSFRS 1107

  Fly   497 C-----RLSYGGYYEEIQIKAQREIMK 518
            .     .|| ....|||:...:||:|:
 Worm  1108 VSPYVENLS-DNDDEEIRRVLRREMMR 1133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 54/211 (26%)
Nucleotidyl_cyc_III 292..445 CDD:299850 45/166 (27%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
gcy-4NP_496218.2 PBP1_NPR_GC_like 29..457 CDD:107347
ANF_receptor 49..423 CDD:279440
PKc_like 558..819 CDD:304357
HNOBA <834..876 CDD:285003 11/53 (21%)
CYCc 855..1047 CDD:214485 57/221 (26%)
Guanylate_cyc 882..1070 CDD:278633 50/199 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.