DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and gcy-1

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:282 Identity:82/282 - (29%)
Similarity:147/282 - (52%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 QNIVYQ---LVMKKENGLLESI--LPRKMIRTLQEEICSRIEDQDKNFT--------------PS 282
            :||..|   ||.|::..|::.:  :..:...||:||    ||::.|..|              |.
 Worm   817 ENICSQMKGLVSKQKTNLMDHVFNMLEEYTSTLEEE----IEERTKELTLEKKKADILLSRMLPK 877

  Fly   283 ------KAGLRKLFLEP--YPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRA 339
                  |||..   :||  :.:|::..:|:|.:|.|.:.....|.|.:|:||:.|||....::..
 Worm   878 QVAERLKAGQT---VEPEGFDSVTVFFSDVVKFTILASKCSPFQTVNLLNDLYSNFDTIIEQHGV 939

  Fly   340 MRIKFLGDSYNCVAGIP--NYFPAHASCCVDQALEMIHITQGVS---SRRELDINLRIGVHSGEV 399
            .:::.:||.|.||:|:|  |.: ||....||.:|:.:...:..:   ..|| ::.|||||:||..
 Worm   940 YKVESIGDGYLCVSGLPTRNGY-AHIKQIVDMSLKFMEYCKSFNIPHLPRE-NVELRIGVNSGPC 1002

  Fly   400 FAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDEHYIFREGTEAAKNDPILQQ 464
            .||::|.:..::.::...|:..:|:||:|.|.|:|::....|:|..||..:..| :::.:.|::.
 Worm  1003 VAGVVGLSMPRYCLFGDTVNTASRMESNGKPSLIHLTNDAHSLLTTHYPNQYET-SSRGEVIIKG 1066

  Fly   465 AGI-RTFLVSNRLPDAVEPGEL 485
            .|: .||.|..|..: :||.||
 Worm  1067 KGVMETFWVHGRFGE-MEPTEL 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 65/226 (29%)
Nucleotidyl_cyc_III 292..445 CDD:299850 50/159 (31%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357 2/3 (67%)
HNOBA <840..883 CDD:285003 9/46 (20%)
CYCc 862..1051 CDD:214485 55/193 (28%)
Guanylate_cyc 889..1077 CDD:278633 58/190 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.