DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and gcy-20

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_507101.1 Gene:gcy-20 / 184797 WormBaseID:WBGene00001545 Length:1108 Species:Caenorhabditis elegans


Alignment Length:302 Identity:79/302 - (26%)
Similarity:137/302 - (45%) Gaps:48/302 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NLIFSFFTIIRDYG--LRRAILSRYQLVYQNIVYQLVMKKENGLLESILPRKMIRTLQEEICSRI 272
            ||:...|.::..|.  |...:..|.:.:.:.      .||.:.||..:|||.:...|  ::...:
 Worm   811 NLMDHVFNMLETYASTLEEEVSDRTKELTEE------KKKSDVLLYRMLPRMVADKL--KLGQTV 867

  Fly   273 EDQDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRN 337
            |.                 |.:..|:|..:|:|.:|.|.......|:|.:|:||:..||....:|
 Worm   868 EP-----------------ETFEQVTIFFSDVVQFTTLAGKCTPLQVVTLLNDLYTIFDGIIEQN 915

  Fly   338 RAMRIKFLGDSYNCVAGIPN-------YFPAHASCCVDQALEMIHITQGVSSRRELDINLRIGVH 395
            ...:::.:||.|.||:|:|:       ...|..|.....:||...: |.:.:.|   ||||||::
 Worm   916 DVYKVETIGDGYLCVSGLPHRNGNDHIRHIARMSLGFLSSLEFFRV-QHLPAER---INLRIGIN 976

  Fly   396 SGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDEHY-IFREGTEAAKND 459
            .|.|.||::|.|..::.::...|:..:|:||:|.||.:||:.....||.:.. .||  || ::.:
 Worm   977 CGSVVAGVVGLTMPRYCLFGDAVNTASRMESNGKPGQIHVTAEANRMLTQVVGGFR--TE-SRGE 1038

  Fly   460 PILQQAGI-RTFLVSNR-----LPDAVEPGELDDELSSASIN 495
            .|::..|: .||.:...     .|....|..:....|..||:
 Worm  1039 VIIKGKGVMETFWLLGEESGYTAPSKAAPKVIQHRQSIRSIS 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 58/205 (28%)
Nucleotidyl_cyc_III 292..445 CDD:299850 51/159 (32%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
gcy-20NP_507101.1 PBP1_NPR_GC_like 22..439 CDD:107347
ANF_receptor 44..418 CDD:279440
PKc_like 536..801 CDD:304357
STYKc 562..801 CDD:214568
HNOBA <818..861 CDD:285003 10/48 (21%)
CYCc 840..1032 CDD:214485 60/220 (27%)
Guanylate_cyc 867..1054 CDD:278633 60/210 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.