DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Npr3

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:168 Identity:39/168 - (23%)
Similarity:57/168 - (33%) Gaps:51/168 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   873 LHEIICCFD---DLLVDYQTRY--KIEKIKVM---GWT---YMVAC---GLETDHYTDFSIDIPV 923
            ||.....||   ||.:|...||  ..|::.:|   |.|   .|:|.   |:.:..|..|:|::..
Mouse   224 LHTSAYNFDETKDLDLDDIVRYIQGSERVVIMCASGDTIRRIMLAVHRHGMTSGDYAFFNIELFN 288

  Fly   924 KQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVL--VMTEFALDLLRI----- 981
            .....|...|||..         .|.|     ..|.|:.:|.|.:|  |..||....:.:     
Mouse   289 SSSYGDGSWRRGDK---------HDSE-----AKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVE 339

  Fly   982 ----------------MHDIRYNYVFSEYDTFLTGSLK 1003
                            .||....||.:.::....|..|
Mouse   340 KQGLNEEDYVNMFVEGFHDAILLYVLALHEVLRAGYSK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 39/168 (23%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 39/168 (23%)
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 39/168 (23%)
ANF_receptor 66..419 CDD:279440 39/168 (23%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.