DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Npr1

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_032753.5 Gene:Npr1 / 18160 MGIID:97371 Length:1057 Species:Mus musculus


Alignment Length:298 Identity:86/298 - (28%)
Similarity:123/298 - (41%) Gaps:76/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 ERHVNYLRKFNYFMRVCYEEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRPHDQLYYENFSKV 853
            |::.|.|.:.       .||..|...|:.|..:.::..|||..||:..|   ..:.:..|.|..|
Mouse   817 EQYANNLEEL-------VEERTQAYLEEKRKAEALLYQILPHSVAEQLK---RGETVQAEAFDSV 871

  Fly   854 AVMFASIENFNADTAG------LRILHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVACGLETD 912
            .:.|:.|..|.|.:|.      :.:|:::..|||.::.::.. ||:|.|   |..|||..||   
Mouse   872 TIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDV-YKVETI---GDAYMVVSGL--- 929

  Fly   913 HYTDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMTEFALD 977
                              .:|.|.    :|                    .::||     ..||.
Mouse   930 ------------------PVRNGQ----LH--------------------AREVA-----RMALA 947

  Fly   978 LLRIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSSTGLL 1042
            ||..:...|..:...|     ...|:|||..|.|.||||||..|.|.::|.|||.||||.|.|..
Mouse   948 LLDAVRSFRIRHRPQE-----QLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEA 1007

  Fly  1043 DNIQVTRHTAKVLRQFN-IRCNYRGHTEVKGVGKVPTY 1079
            ..|.::..|..||.:|: .....||..|:||.|||.||
Mouse  1008 LRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTY 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 68/247 (28%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 72/242 (30%)
Npr1NP_032753.5 PBP1_NPR_A 32..439 CDD:107380
ANF_receptor 50..410 CDD:279440
PK_GC-A_B 530..803 CDD:270944
TyrKc 543..797 CDD:197581
HNOBA <812..857 CDD:285003 13/46 (28%)
CYCc 836..1025 CDD:214485 70/250 (28%)
Guanylate_cyc 863..1049 CDD:278633 72/242 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.