DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and gcy-29

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:245 Identity:56/245 - (22%)
Similarity:121/245 - (49%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NLIFSFFTIIRDY--GLRRAILSRYQLVYQ-NIVYQLVMKKENGLLESILPRKMIRTLQEEICSR 271
            ||:.|...::.:|  .|.:.:..|.:|..: |:       :...||..:||:.:...|       
 Worm   811 NLVDSMMRMMEEYANNLEKLVGERTKLAEEANL-------RAERLLFQLLPKHVAIEL------- 861

  Fly   272 IEDQDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANR 336
                       ||| |.:..:.|.:.:::.:|:|.:|.|.:.....::|.:|:.|:..||...::
 Worm   862 -----------KAG-RTVAPKMYDSATVMFSDIVGFTKLCSASTPIEVVNLLNKLYSEFDTVISK 914

  Fly   337 NRAMRIKFLGDSYNCVAGIP----NYFPAHASCCVDQALEMIHITQGVSSRRELDINLRIGVHSG 397
            :...:::.:||:|..|:|||    ....|:.|......::::.:.: |..||:..:.:|:|..||
 Worm   915 HDCYKVETIGDAYMVVSGIPIENGQRHVANISAVTLGIMDLLKVFE-VPHRRDYRLTIRLGFASG 978

  Fly   398 EVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDEHY 447
            :|.|.::|.:..::.::.:.|:|...:||||..|.|.:::.:..:|:..|
 Worm   979 QVSAAVVGLSSPRYCLFGETVNIAAVMESSGEGGRVQITETSKILLENEY 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 48/201 (24%)
Nucleotidyl_cyc_III 292..445 CDD:299850 38/156 (24%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665
CYCc 840..1033 CDD:214485 49/216 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.