DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and gucy2f

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:287 Identity:78/287 - (27%)
Similarity:125/287 - (43%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   808 EAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRPHDQLYYEN----FSKVAVMFASIENFNADTA 868
            |..:|..|||      ::.:||..||:..|.....:..|::.    ||.: |.|.:|.:.:....
Zfish   848 EVEKQRTEKL------LSEMLPPSVAEALKTGASVEPEYFDQVTIYFSDI-VGFTTISSLSDPIE 905

  Fly   869 GLRILHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVACGLETDHYTDFSIDIPVKQPEADSEIR 933
            .:.:|:::...||.:|..:.. ||:|.|   |..||||.||            |.|         
Zfish   906 VVDLLNDLYSLFDAVLGSHDV-YKVETI---GDAYMVASGL------------PKK--------- 945

  Fly   934 RGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMTEFALDLLRIMHDIRYNYVFSEYDTFL 998
                                 |.::..|::.::::.:::......:|.|.::...          
Zfish   946 ---------------------NGNKHAAEIANMSLNILSSVGSFKMRHMPEVPVR---------- 979

  Fly   999 TGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSSTGLLDNIQVTRHTAKVLRQFN--IR 1061
               ::|||..|..:||||||:.|.|.::|.|||.||||.||||...|.|...|.::||..|  .:
Zfish   980 ---IRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNISTVQILRSLNDGYK 1041

  Fly  1062 CNYRGHTEVKGVGKVPTYLVVVDPDLT 1088
            .:.||.||:||.|...||.:|...:.|
Zfish  1042 IDVRGKTELKGKGIEETYWLVGKANFT 1068

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 62/245 (25%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 66/241 (27%)
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945
HNOBA <825..870 CDD:311573 9/27 (33%)
CYCc 850..1042 CDD:214485 66/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.