DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Npr2

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_446290.1 Gene:Npr2 / 116564 RGDID:620851 Length:1047 Species:Rattus norvegicus


Alignment Length:303 Identity:84/303 - (27%)
Similarity:125/303 - (41%) Gaps:77/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 LVLR-ERHVNYLRKFNYFMRVCYEEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRPHDQLYYE 848
            |:|| |::.|.|.|.       .||..|...|:.|..:.::..|||..||:..|   ..:.:..|
  Rat   801 LLLRMEQYANNLEKL-------VEERTQAYLEEKRKAEALLYQILPHSVAEQLK---RGETVQAE 855

  Fly   849 NFSKVAVMFASIENFNADTAG------LRILHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVAC 907
            .|..|.:.|:.|..|.|.:|.      :.:|:::..|||.::.::.. ||:|.|   |..|||..
  Rat   856 AFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDV-YKVETI---GDAYMVVS 916

  Fly   908 GLETDHYTDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMT 972
            ||                                          .|.|..:...::..:|:.::.
  Rat   917 GL------------------------------------------PGRNGQRHAPEIARMALALLD 939

  Fly   973 EFALDLLRIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMS 1037
              |:...||.|        ..:|..   .|:||:..|.|.||||||..|.|.::|.|||.||||.
  Rat   940 --AVSSFRIRH--------RPHDQL---RLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRME 991

  Fly  1038 STGLLDNIQVTRHTAKVLRQFN-IRCNYRGHTEVKGVGKVPTY 1079
            |.|....|.|:..|...|.:.. .:...||..|:||.||:.||
  Rat   992 SNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTY 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 64/247 (26%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 66/242 (27%)
Npr2NP_446290.1 PBP1_NPR_B 26..421 CDD:380607
PK_GC-A_B 518..792 CDD:270944
HNOBA <798..846 CDD:400168 17/51 (33%)
CYCc 825..1009 CDD:214485 64/245 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.