DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and LOC100333871

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:XP_002666572.2 Gene:LOC100333871 / 100333871 -ID:- Length:243 Species:Danio rerio


Alignment Length:157 Identity:41/157 - (26%)
Similarity:86/157 - (54%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 EPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAGIP 356
            :.|.:.::..:|:|.:|.|::|....|:|:.|:.|:..||...:.:...:::.:||:|..|:|:|
Zfish    19 QSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHDVYKVETIGDAYMVVSGVP 83

  Fly   357 NYFP-AHASCCVDQALEMIHI--TQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDV 418
            .... .|||...:.||:::.:  |..:..|.:..:.:|.|:|||.|.||::|....::.::...|
Zfish    84 RENGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTV 148

  Fly   419 DITNRLESSGLPGLVHVSQRTLSMLDE 445
            :..:|:||:.....:..|.....:|:|
Zfish   149 NTASRMESTSEALKIQCSSSAFYLLEE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 41/157 (26%)
Nucleotidyl_cyc_III 292..445 CDD:299850 40/155 (26%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
LOC100333871XP_002666572.2 CYCc 1..179 CDD:214485 41/157 (26%)
Guanylate_cyc 16..202 CDD:278633 41/157 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.