Sequence 1: | NP_728725.2 | Gene: | CG32305 / 317967 | FlyBaseID: | FBgn0052305 | Length: | 1164 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002666572.2 | Gene: | LOC100333871 / 100333871 | -ID: | - | Length: | 243 | Species: | Danio rerio |
Alignment Length: | 157 | Identity: | 41/157 - (26%) |
---|---|---|---|
Similarity: | 86/157 - (54%) | Gaps: | 3/157 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 292 EPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAGIP 356
Fly 357 NYFP-AHASCCVDQALEMIHI--TQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDV 418
Fly 419 DITNRLESSGLPGLVHVSQRTLSMLDE 445 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32305 | NP_728725.2 | CYCc | 251..449 | CDD:214485 | 41/157 (26%) |
Nucleotidyl_cyc_III | 292..445 | CDD:299850 | 40/155 (26%) | ||
CYCc | 814..1056 | CDD:214485 | |||
Nucleotidyl_cyc_III | 845..1081 | CDD:299850 | |||
LOC100333871 | XP_002666572.2 | CYCc | 1..179 | CDD:214485 | 41/157 (26%) |
Guanylate_cyc | 16..202 | CDD:278633 | 41/157 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |