DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-I and Gasp

DIOPT Version :9

Sequence 1:NP_728731.1 Gene:obst-I / 317966 FlyBaseID:FBgn0052304 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:84/224 - (37%) Gaps:67/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AAAES---CPDDYYFNETIQACVSTDTTSCTNHQIGKCPMATEMDEFCVCKDKHLQIWKCPEGTY 95
            |.|:|   ||||:                      |..|..|..|::..|.:...::..|..|..
  Fly    15 AVAQSSFKCPDDF----------------------GFYPHDTSCDKYWKCDNGVSELKTCGNGLA 57

  Fly    96 FDA--NRLVCR----VGSVECQD------DYTPSPC-------PNSTASDVFCLCIDGKWHLNYC 141
            |||  ::.:..    :.:|:|.|      ..|...|       |:....|||..|.:|:.....|
  Fly    58 FDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQC 122

  Fly   142 PTGFTFDDELQICLNTGSDDDELPS-------------SSGKCQRLGLF---GDPADCSGYYHCR 190
            ..|..:|.:.::|:..    |::|.             ::|:....|.|   ..|.||..||.|.
  Fly   123 SPGLAYDRDARVCMWA----DQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICL 183

  Fly   191 EKGSDIEYFRCSVGTIFNLISFACVTGTC 219
            | |...|| .|.:||:|. |..:..||.|
  Fly   184 E-GVAREY-GCPIGTVFK-IGDSDGTGNC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-INP_728731.1 None
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 14/72 (19%)
CBM_14 97..144 CDD:366726 12/50 (24%)
CBM_14 170..218 CDD:366726 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.