powered by:
Protein Alignment CG32298 and CG32299
DIOPT Version :9
Sequence 1: | NP_728742.1 |
Gene: | CG32298 / 317963 |
FlyBaseID: | FBgn0052298 |
Length: | 200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001137874.1 |
Gene: | CG32299 / 317964 |
FlyBaseID: | FBgn0052299 |
Length: | 134 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 23/67 - (34%) |
Similarity: | 38/67 - (56%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 QGLSKKIIDILPYLEVSFLSWPAFWIWRGYNWQSARKTERIAFYIQRTYQQAKLMQLAILATGLF 169
|...|......|:|..|..:||.:|::||.::...|....:..||::||.|||::||.|:..|.:
Fly 49 QSFEKAYSTAAPFLFASLGAWPGYWLFRGMDYHVHRSHIPLPIYIRQTYYQAKVVQLFIIMAGTY 113
Fly 170 TI 171
|:
Fly 114 TV 115
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45454068 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2FAUH |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0020005 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.830 |
|
Return to query results.
Submit another query.