DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32298 and CG32299

DIOPT Version :9

Sequence 1:NP_728742.1 Gene:CG32298 / 317963 FlyBaseID:FBgn0052298 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001137874.1 Gene:CG32299 / 317964 FlyBaseID:FBgn0052299 Length:134 Species:Drosophila melanogaster


Alignment Length:67 Identity:23/67 - (34%)
Similarity:38/67 - (56%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QGLSKKIIDILPYLEVSFLSWPAFWIWRGYNWQSARKTERIAFYIQRTYQQAKLMQLAILATGLF 169
            |...|......|:|..|..:||.:|::||.::...|....:..||::||.|||::||.|:..|.:
  Fly    49 QSFEKAYSTAAPFLFASLGAWPGYWLFRGMDYHVHRSHIPLPIYIRQTYYQAKVVQLFIIMAGTY 113

  Fly   170 TI 171
            |:
  Fly   114 TV 115



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAUH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020005
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.