DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CLEC6A

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001007034.1 Gene:CLEC6A / 93978 HGNCID:14556 Length:209 Species:Homo sapiens


Alignment Length:140 Identity:29/140 - (20%)
Similarity:47/140 - (33%) Gaps:40/140 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFK----------NNDY 106
            |.:.|:|....|| |.::...|..|.|||.....:.|...:::.:. :.|.          ||::
Human    87 GSSCYFISSEEKV-WSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLN-ESFSYFLGLSDPQGNNNW 149

  Fly   107 FWISGNDLGTEGAFYWMSNGRPMTYAP-------WNGPKQMPDNYGGNENCVHMFATREMINDAN 164
            .||..........|:.:  |.|...|.       |.     |..:|.              ||..
Human   150 QWIDKTPYEKNVRFWHL--GEPNHSAEQCASIVFWK-----PTGWGW--------------NDVI 193

  Fly   165 CKIQMLYVCE 174
            |:.:...:||
Human   194 CETRRNSICE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 26/135 (19%)
CLEC6ANP_001007034.1 CLECT_DC-SIGN_like 79..204 CDD:153060 29/140 (21%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 168..170 0/1 (0%)