DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Sfp24F

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster


Alignment Length:151 Identity:55/151 - (36%)
Similarity:81/151 - (53%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GIPSEIDTT--PFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKG 100
            |....:.||  .|||||::||.||...:.|||.|...||...|.|.|:|...|:..:.:|:.|  
  Fly    26 GALEALQTTNDTFVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLA-- 88

  Fly   101 FKNN--DYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFA----TREM 159
              ||  :.:|.||.||||:|...|.|||:|::...|.|.:  |:|....|:|..:.:    |:..
  Fly    89 --NNIFERYWTSGTDLGTKGKHVWFSNGQPLSTDLWYGGE--PNNKNNEEHCDELGSDFRPTKSP 149

  Fly   160 -INDANCKIQMLYVCEATEPK 179
             :||.||..:..::||..:||
  Fly   150 GMNDRNCNFESSFICEEVQPK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 43/125 (34%)
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 43/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I7429
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26853
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 1 1.000 - - otm43824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
87.980

Return to query results.
Submit another query.