DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CLEC3B

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_016862606.1 Gene:CLEC3B / 7123 HGNCID:11891 Length:209 Species:Homo sapiens


Alignment Length:108 Identity:28/108 - (25%)
Similarity:47/108 - (43%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYA 132
            :|:..|......|.:.:...|.:||.:|:: :...|....|:..||:..||.:..|:..| :.|.
Human   100 EASEDCISRGGTLGTPQTGSENDALYEYLR-QSVGNEAEIWLGLNDMAAEGTWVDMTGAR-IAYK 162

  Fly   133 PWNGPKQMPDNYGGNENC-VHMFATREMINDANCKIQMLYVCE 174
            .|........:.|..||| |...|......|..|:.|:.|:|:
Human   163 NWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 27/106 (25%)
CLEC3BXP_016862606.1 CLECT_tetranectin_like 78..206 CDD:153066 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.