DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd209b

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_081248.4 Gene:Cd209b / 69165 MGIID:1916415 Length:325 Species:Mus musculus


Alignment Length:133 Identity:35/133 - (26%)
Similarity:59/133 - (44%) Gaps:28/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKG---------FKNNDY 106
            :|:.|::.:  ::.||..|..||:.:.|.|..|....|...|.:..||||         .|...:
Mouse   203 LGNCYFFSK--SQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATW 265

  Fly   107 FWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLY 171
            .|:.|:.|.:....|| :.|.|              |..|.|:||. || .:..||:.|:::..:
Mouse   266 LWVDGSTLSSRFQKYW-NRGEP--------------NNIGEEDCVE-FA-GDGWNDSKCELKKFW 313

  Fly   172 VCE 174
            :|:
Mouse   314 ICK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 33/127 (26%)
Cd209bNP_081248.4 CLECT_DC-SIGN_like 195..317 CDD:153060 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.