DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd209f

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:124 Identity:31/124 - (25%)
Similarity:57/124 - (45%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFY 121
            |:......:|..:|.:|:.:.|||..:....|.:    ::|....:.:...||..:|...||::.
  Rat   155 YLFSRTLASWGASASSCKDLGAHLVIVNSVAEQQ----FLKYWHIRQSQLTWIGLSDHQREGSWQ 215

  Fly   122 WMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCEATEPKT 180
            |:.: .|:..:.|   |:...|..|:|:||  ....:..||:.|.....:|||  :|.|
  Rat   216 WVDD-TPLKLSFW---KEGEPNNAGDEDCV--VIAEDKWNDSTCSANNFWVCE--QPST 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 27/116 (23%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.