DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Clec5a

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001102847.1 Gene:Clec5a / 679787 RGDID:1584755 Length:190 Species:Rattus norvegicus


Alignment Length:119 Identity:30/119 - (25%)
Similarity:48/119 - (40%) Gaps:27/119 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGT-----EGAFYWMSN 125
            |..:...|....:.|| |.|.|:.   :|:::.:....| ||      :|.     |..:.|::|
  Rat    94 WKNSRDYCATKGSTLA-IVDTPKK---LKFLQDRAGAEN-YF------IGLIRQPGEKKWRWVNN 147

  Fly   126 GRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCEATEPK 179
                     :..|....|...|.|||.:..|. ..:.|:|.|...::||.| ||
  Rat   148 ---------SVFKGNVTNQEQNFNCVTIGLTM-TFDAASCDISYRWICETT-PK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 25/112 (22%)
Clec5aNP_001102847.1 CLECT_NK_receptors_like 73..186 CDD:153063 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.