DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and illr3

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_021323809.1 Gene:illr3 / 677740 ZFINID:ZDB-GENE-050311-4 Length:285 Species:Danio rerio


Alignment Length:137 Identity:42/137 - (30%)
Similarity:60/137 - (43%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGT 116
            |:..||...: |:||.|:...|.....||..|..:.|.|.|...:|       :..||..|||.|
Zfish   155 GEKCYYFSTV-KMNWTQSRDHCVTKGGHLVIITSQAEQEFLTSNVK-------ETHWIGLNDLDT 211

  Fly   117 EGAFYWMSNGRPMTYAP--W----NGPKQMPDNYG----GNENCV---HMFATREMINDANCKIQ 168
            ||.:.|:.| :|::...  |    ||..: |||:.    ..|:|.   |.....:...||.|..:
Zfish   212 EGRWLWVDN-QPLSQTEEFWMKRENGVSE-PDNWTKQHVDGEDCASLGHPDGETDFWTDAYCFEE 274

  Fly   169 MLYVCEA 175
            ..:||||
Zfish   275 KRFVCEA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 38/131 (29%)
illr3XP_021323809.1 CLECT_DC-SIGN_like 147..280 CDD:153060 39/134 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5439
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.