DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Clec10a

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:138 Identity:35/138 - (25%)
Similarity:57/138 - (41%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YYIEPMNKVNWFQAAGA--------CRMMNAHLASIEDKPEMEALIKYMKAK----GF--KNNDY 106
            :::|......||..:|.        |::.|::|.::....|...|..:|.:.    |.  :|..:
  Rat   179 HWMEHEGSCYWFSQSGKPWPEADKYCQLENSNLVAVNSLAEQNFLQTHMGSVVTWIGLTDQNGPW 243

  Fly   107 FWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNY-----GGNENCVHMFATREMINDANCK 166
            .|:.|.|. .:|..:|             .||| |||:     ||.|:|.| |.:....||..|:
  Rat   244 RWVDGTDY-EKGFTHW-------------APKQ-PDNWYGHGLGGGEDCAH-FTSDGRWNDDVCQ 292

  Fly   167 IQMLYVCE 174
            ....:|||
  Rat   293 RPYRWVCE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 33/136 (24%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887
Apolipoprotein <63..166 CDD:279749
CLECT_DC-SIGN_like 176..301 CDD:153060 35/138 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.