DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and BCAN

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_016857536.1 Gene:BCAN / 63827 HGNCID:23059 Length:956 Species:Homo sapiens


Alignment Length:115 Identity:44/115 - (38%)
Similarity:56/115 - (48%) Gaps:18/115 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNN---DYFWISGNDLGTEGAFYWMSNG 126
            :|.:|...|||..||||||....|.:          |.||   :|.||..||...||.|.| |:|
Human   753 SWEEAETQCRMYGAHLASISTPEEQD----------FINNRYREYQWIGLNDRTIEGDFLW-SDG 806

  Fly   127 RPMTYAPWNGPKQMPDNYG-GNENCVHM-FATREMINDANCKIQMLYVCE 174
            .|:.|..|| |.| ||:|. ..||||.| :..:...:|..|...:.|.|:
Human   807 VPLLYENWN-PGQ-PDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCK 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 43/113 (38%)
BCANXP_016857536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8850
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41755
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.