DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CLEC11A

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_002966.1 Gene:CLEC11A / 6320 HGNCID:10576 Length:323 Species:Homo sapiens


Alignment Length:128 Identity:37/128 - (28%)
Similarity:56/128 - (43%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FQAAGA----CRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGR 127
            |:|..|    |......||...|:.:||||.:|::|.....|...|:..:|...|| .|...||:
Human   194 FEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEG-LYLFENGQ 257

  Fly   128 PMTYAPWN-GPKQ-------------MPD--NYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            .:::..|: .|:.             .||  |.|..||||...:......|.:|:.::.||||
Human   258 RVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/126 (28%)
CLEC11ANP_002966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..106
Cell attachment site. /evidence=ECO:0000255 61..63
CLECT_tetranectin_like 177..321 CDD:153066 37/128 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..295 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.