DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and hbl2

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_009296949.2 Gene:hbl2 / 566971 ZFINID:ZDB-GENE-070912-286 Length:253 Species:Danio rerio


Alignment Length:158 Identity:40/158 - (25%)
Similarity:71/158 - (44%) Gaps:18/158 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NIFTNYRTEVYNGIPSEIDT-------TPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASI 83
            ::..:.::|:.| :.:||||       :.|.|:|..||..:.: ..|:......|:.....|...
Zfish   102 SVIESLKSEIQN-LKAEIDTIEKAASFSNFRRVGQKYYVTDGI-LGNFNDGIKFCKDAGGTLVVP 164

  Fly    84 EDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNE 148
            :...|.:||::...:........: |...|..|||.|..: .|:.:|:..| ||.| ||:|.|.:
Zfish   165 KTAAENQALVRVSVSSALSTGKPY-IGVTDRETEGQFVDI-EGKQLTFTNW-GPGQ-PDDYRGGQ 225

  Fly   149 NC--VHMFATREMINDANCKIQMLYVCE 174
            :|  :.:..|.:   |.||......:||
Zfish   226 DCGVIEVSGTWD---DGNCGDIRPIICE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 29/120 (24%)
hbl2XP_009296949.2 Collagen <36..70 CDD:189968
CLECT_collectin_like 135..251 CDD:153061 31/124 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.