DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and si:ch211-225k7.6

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001093462.1 Gene:si:ch211-225k7.6 / 558654 ZFINID:ZDB-GENE-070705-121 Length:359 Species:Danio rerio


Alignment Length:171 Identity:45/171 - (26%)
Similarity:71/171 - (41%) Gaps:37/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVNIFTNYRTEVYNGIPSEIDTTPFVRIG--------DNYYYI-EPMNK--------VNWFQAAG 71
            |..:|.|:.    :|.|...|...|:|.|        |.::.| ..|::        :||..|..
Zfish    83 DPELFLNWE----SGQPDGKDECAFMRHGKWHDGKCSDTWFVICYNMSRGLVFVNQTMNWRAAQS 143

  Fly    72 ACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNG 136
            .||..:..|.|:.::.|.:.|.|::.......:| .||     |....:.| |:....:::.|| 
Zfish   144 YCRQNHIDLVSVRNQNESQQLEKFINDSIPSRSD-VWI-----GLFRDWQW-SDQSNYSFSYWN- 200

  Fly   137 PKQMPDNYGGNENCVHMFATREMIN----DANCKIQMLYVC 173
             ...|:|||.||||.   ..:|..|    |.:|..|..:||
Zfish   201 -TNEPNNYGNNENCT---VLKENTNGHWADISCDCQFPFVC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/132 (27%)
si:ch211-225k7.6NP_001093462.1 CLECT 23..124 CDD:295302 11/44 (25%)
CLECT 127..238 CDD:295302 33/123 (27%)
CLECT 244..356 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D605458at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.