DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:143 Identity:44/143 - (30%)
Similarity:74/143 - (51%) Gaps:15/143 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYM 96
            :||    |||:     |.:||..:::||..:||:||:|...|..|.|||.:|:.:.|::|:...:
  Fly   138 KTE----IPSQ-----FQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTEL 193

  Fly    97 KAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMIN 161
            |.....::| ||:..||:...|.|..::.|....:..|:  |..| ....::.|||:.....|  
  Fly   194 KDINDGSHD-FWLDINDIAKWGEFISLATGMNPPFLKWH--KHRP-QVQIHQRCVHLRGGEMM-- 252

  Fly   162 DANCKIQMLYVCE 174
            |..|..|.|::|:
  Fly   253 DGKCSEQFLFICQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/118 (30%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.