DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and lectin-24Db

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:141 Identity:37/141 - (26%)
Similarity:71/141 - (50%) Gaps:14/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKA 98
            |:|    :::....|.|||...:||...:..:|..|...||.|..::|:|:|:.|::|:...:..
  Fly   228 EIY----TKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDD 288

  Fly    99 KGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDA 163
            |.      :|:..|||.:...:..:::||.:.:..||..:  |::...:||||.:.  |..:||.
  Fly   289 KS------YWLGINDLQSSNTYVSVASGREVEFLNWNAGE--PNHGNEDENCVELI--RSKMNDD 343

  Fly   164 NCKIQMLYVCE 174
            .|..:...:|:
  Fly   344 PCHRKKHVICQ 354

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 30/118 (25%)
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411