DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and lectin-30A

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:139 Identity:42/139 - (30%)
Similarity:64/139 - (46%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKN 103
            |...|:...|.|:|...:|||..||.|||.|:..||.:..|:|:|.|:.|...:.....|     
  Fly    96 ISHRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFSRAPA----- 155

  Fly   104 NDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQ 168
             ..|||..|.:...|.|.....||...:..|.     .:..|...:||::: .:||.|: ||...
  Fly   156 -GVFWIDMNAMFKNGLFASSLTGRSPPFFKWK-----KEERGNKFDCVNVY-NKEMYNE-NCFNT 212

  Fly   169 MLYVCEATE 177
            .|::|:|.:
  Fly   213 HLFICQAEQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/118 (30%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 32/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.