DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and lectin-46Ca

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:139 Identity:37/139 - (26%)
Similarity:71/139 - (51%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PFVR-IGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAK-GFKNNDYFWI 109
            |::| :....:|: .:.|:|||.|...|.....:||.:....:.:|::.|:.:: ||   |.||.
  Fly    35 PYLRELNGKCFYV-GIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGF---DDFWF 95

  Fly   110 SGNDLGTEGAFYWMSNGRPMTYAPWNGPKQM--PDNYGGNENC--VHMFATREMINDANCKIQML 170
            .||||.:||.|.::|:|:.:.|.   |...:  |......::|  :.:.....::.|.||:.:..
  Fly    96 GGNDLQSEGRFKYISSGKLVRYM---GDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKY 157

  Fly   171 YVCEATEPK 179
            ::||..:.|
  Fly   158 FICEQNQMK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 32/123 (26%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.