DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and lectin-46Cb

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001163102.1 Gene:lectin-46Cb / 53522 FlyBaseID:FBgn0040092 Length:322 Species:Drosophila melanogaster


Alignment Length:126 Identity:37/126 - (29%)
Similarity:61/126 - (48%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDL 114
            ||....||.. :.|:|||.|...|......||.:.::.:.:..|.::  .|..|.:.||..||||
  Fly    34 RINGKCYYFS-VKKMNWFGALNNCLRKGLTLADLSNQRDFDGAIGFL--SGLGNTEDFWFGGNDL 95

  Fly   115 GTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATRE--MINDANCKIQMLYVC 173
            ..||.|.::||||.:.|.. |....:|..:...::|:.:....|  |::..||..:..::|
  Fly    96 YHEGRFQYISNGRLVRYYS-NYSNVLPLEHSECDDCLEVRIRSEINMVSADNCHERQYFIC 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/121 (29%)
lectin-46CbNP_001163102.1 CLECT 38..155 CDD:153057 34/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.