DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and lectin-33A

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster


Alignment Length:139 Identity:40/139 - (28%)
Similarity:64/139 - (46%) Gaps:12/139 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYF---- 107
            ||.|:|:..|::. :.:.||..|..:||.:.|.|..::::.:......::|:.|......:    
  Fly    27 PFSRVGNKCYHVS-LQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSV 90

  Fly   108 WISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATRE---MINDANCKIQM 169
            |...|.||....|....||..:.|..| .|.: |:|....|:||. ||...   ..:|..||:|.
  Fly    91 WAGINCLGNRRTFLLARNGETVPYLNW-VPLE-PNNASPEEDCVG-FANYNGAFGYHDIECKVQF 152

  Fly   170 LYVCEATEP 178
            .|||: .||
  Fly   153 PYVCQ-REP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 33/125 (26%)
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 37/133 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.