DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CLEC4A

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:131 Identity:33/131 - (25%)
Similarity:52/131 - (39%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEG 118
            |.|:|. ....:|..:...|..|.|||..|..:.|.:.:.:.::    :.:.|| :..:|  .||
Human   116 NCYFIS-TESASWQDSEKDCARMEAHLLVINTQEEQDFIFQNLQ----EESAYF-VGLSD--PEG 172

  Fly   119 AFYWMSNGRPMTYAPWN------GPKQMPDNYGGNENCV----HMFATREMINDANCKIQMLYVC 173
            ..:|    :.:...|:|      .|::..|   .||.||    .....|...||.||......||
Human   173 QRHW----QWVDQTPYNESSTFWHPREPSD---PNERCVVLNFRKSPKRWGWNDVNCLGPQRSVC 230

  Fly   174 E 174
            |
Human   231 E 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 30/128 (23%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 33/131 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.