DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Clec7a

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001166857.1 Gene:Clec7a / 502902 RGDID:1565140 Length:235 Species:Rattus norvegicus


Alignment Length:122 Identity:29/122 - (23%)
Similarity:52/122 - (42%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFY 121
            |:...::.:|:.:...|..:.|||..|::..|.| .|:...:....|:  |||..:...:||.::
  Rat   122 YLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFE-FIESQTSSHRVNS--FWIGLSRNQSEGPWF 183

  Fly   122 WMSNG--RPMTYAPWNGPKQ--MPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            |....  .|.::...|...|  :|      .|||.:..: |:.|.. |......:||
  Rat   184 WEDGSAFTPNSFQVRNTAPQESLP------HNCVWIHGS-EVYNQM-CIASSFTICE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 27/120 (23%)
Clec7aNP_001166857.1 Ly49 34..>61 CDD:400616
CLECT_NK_receptors_like 110..233 CDD:153063 29/122 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.