DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd209e

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006248837.1 Gene:Cd209e / 501797 RGDID:1563333 Length:215 Species:Rattus norvegicus


Alignment Length:149 Identity:41/149 - (27%)
Similarity:70/149 - (46%) Gaps:25/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IPSEIDTT------PFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMK 97
            :.||||:.      .:.....|.|:.....: :|..:..||:.|.|.|.:|: .||.::.::...
  Rat    74 LKSEIDSLCRLCPWDWTFFNGNCYFFSKSQR-DWHNSITACQEMEAQLVTIK-SPEEQSFLQQTS 136

  Fly    98 AKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMT-----YAPWNGPKQMPDNYGGNENCVHMFATR 157
                |.|.|.|:..:||..||.:||: :|.|::     |  ||  :..|:|..| ::||..  ..
  Rat   137 ----KKNGYTWMGLSDLNKEGEWYWL-DGSPLSDSLRNY--WN--EGQPNNIDG-QDCVEF--RN 189

  Fly   158 EMINDANCKIQMLYVCEAT 176
            :..|||.|.....::|:.|
  Rat   190 DGWNDAKCDNWKFWICKKT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 34/123 (28%)
Cd209eXP_006248837.1 CLECT_DC-SIGN_like 85..207 CDD:153060 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.