DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Ly49i3

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001009499.1 Gene:Ly49i3 / 494208 RGDID:1359730 Length:280 Species:Rattus norvegicus


Alignment Length:134 Identity:24/134 - (17%)
Similarity:49/134 - (36%) Gaps:44/134 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGA 119
            ||:  .|:...|.:....|:..:.....|:||.|    :|:::....::|  :||..:....:..
  Rat   156 YYF--TMDIRIWRECKQICQNYSLSFLKIDDKDE----LKFLQDHIIRDN--YWIGSSYNNKKKE 212

  Fly   120 FYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREM--------------INDANCKIQML 170
            :.|:.|      :|:|..                |..|.:              ::|.:|..:.|
  Rat   213 WSWIDN------SPFNLD----------------FVARTLLRKTGYCLYFSMSGLHDDDCGKRYL 255

  Fly   171 YVCE 174
            .:||
  Rat   256 CICE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 22/132 (17%)
Ly49i3NP_001009499.1 Ly49 40..158 CDD:400616 1/1 (100%)
CLECT_NK_receptors_like 145..260 CDD:153063 24/134 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.