DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and colec11

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001007332.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:271 Species:Danio rerio


Alignment Length:153 Identity:39/153 - (25%)
Similarity:67/153 - (43%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVNI--FTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDK 86
            |:.:  .||....:.|.:....:|       |:..|:....:..:.:|...|:....|||..:|.
Zfish   126 DIQVVQLTNELKFIKNAVAGIKET-------DSKVYLLVKEEKRYREAEVFCQGRGGHLAMPKDA 183

  Fly    87 PEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCV 151
            ....|:..|:...|...   .:|..|||..||.|.::......|::.|.  :..|:|...:|:||
Zfish   184 AANRAIAGYVTDAGLSR---VYIGINDLEREGHFVYVERSPMTTFSRWR--EGEPNNAYDDEDCV 243

  Fly   152 HMFATREMINDANCKIQMLYVCE 174
            .|.::.|.| |..|::.|.:|||
Zfish   244 EMVSSGEWI-DVACQLTMYFVCE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 31/118 (26%)
colec11NP_001007332.1 gly_rich_SclB <40..>110 CDD:468478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..112
CLECT_collectin_like 151..266 CDD:153061 33/121 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.