DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and colec11

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_009291466.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:277 Species:Danio rerio


Alignment Length:153 Identity:40/153 - (26%)
Similarity:69/153 - (45%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVNI--FTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDK 86
            |:.:  .||....:.|.:||.. ....::..|:..|:....:..:.:|...|:....|||..:|.
Zfish   126 DIQVVQLTNELKFIKNALPSPA-AVAGIKETDSKVYLLVKEEKRYREAEVFCQGRGGHLAMPKDA 189

  Fly    87 PEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCV 151
            ....|:..|:...|...   .:|..|||..||.|.::......|::.|.  :..|:|...:|:||
Zfish   190 AANRAIAGYVTDAGLSR---VYIGINDLEREGHFVYVERSPMTTFSRWR--EGEPNNAYDDEDCV 249

  Fly   152 HMFATREMINDANCKIQMLYVCE 174
            .|.::.|.| |..|::.|.:|||
Zfish   250 EMVSSGEWI-DVACQLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/118 (26%)
colec11XP_009291466.1 Collagen 44..102 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 33/121 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.