DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Clec4b2

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001005896.2 Gene:Clec4b2 / 450222 RGDID:1359354 Length:208 Species:Rattus norvegicus


Alignment Length:137 Identity:29/137 - (21%)
Similarity:54/137 - (39%) Gaps:34/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWI 109
            ||.||              .||.::...|..|.|||..|..:.|.:.:      .|..:..:.:.
  Rat    93 TTDFV--------------ANWNESKEKCSHMGAHLLVIHSQEEQDFI------NGILDTRWGYF 137

  Fly   110 SG-NDLGTEGAFYWMSN---GRPMTYAPWNGPKQMPDNYGGNENCVHMFATREM---INDANCKI 167
            :| :|.| :..:.|:..   ...:|:  |:  :..|:|  ..|.||.:...:::   .||..|..
  Rat   138 TGLSDQG-QNQWQWIDQTPYNESVTF--WH--EDEPNN--DYEKCVEINHHKDIGWGWNDIVCSS 195

  Fly   168 QMLYVCE 174
            :...:|:
  Rat   196 EHKSICQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 24/125 (19%)
Clec4b2NP_001005896.2 CLECT_DC-SIGN_like 79..202 CDD:153060 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.