DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CLEC17A

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:119 Identity:34/119 - (28%)
Similarity:55/119 - (46%) Gaps:11/119 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAF 120
            ||..|..| :|.:|...|:...:||..|....|...:     ||...:...:|:..||...||.:
Human   266 YYFSPSTK-SWDEARMFCQENYSHLVIINSFAEHNFV-----AKAHGSPRVYWLGLNDRAQEGDW 324

  Fly   121 YWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            .|: :|.|:|.:.|. |:: |:|. .:|:|..|...... ||.:|.....::||
Human   325 RWL-DGSPVTLSFWE-PEE-PNNI-HDEDCATMNKGGTW-NDLSCYKTTYWICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 32/117 (27%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
PHA03247 <6..153 CDD:223021
CLECT_DC-SIGN_like 254..374 CDD:153060 34/119 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.