DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CG14500

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_611309.1 Gene:CG14500 / 37087 FlyBaseID:FBgn0034318 Length:190 Species:Drosophila melanogaster


Alignment Length:179 Identity:44/179 - (24%)
Similarity:74/179 - (41%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTSVGIPSLAYLPDVNIFTNYRTEVYNGIPSEIDT---TPFVRIGDNYYYIEPMNKVNWFQAAGA 72
            |..:.:.|||:           .:||.....|..|   |.|.::.|....::...| |::::...
  Fly     6 LVCIALVSLAF-----------GQVYLVASEETITLCPTNFTQVADKCLLVDGSWK-NFYESDRH 58

  Fly    73 CRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGP 137
            ||.:||.|.||.:..|...:.:::.... .....||.|||.||....:||.|.|:...|.||:..
  Fly    59 CRSLNAGLLSISNPTEFNVINEWLPIIA-PYQPEFWTSGNKLGGTSDYYWQSTGQKAVYLPWSAG 122

  Fly   138 KQMPDNYGGNENCVHMFATREMI-NDANCKIQML----------YVCEA 175
            :  |....|  :|:.:.|...|. .:|...:..|          ::|:|
  Fly   123 Q--PTTTAG--DCLTLMANVTMTPEEAILSVHRLTVKPCTQWAPHICQA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/129 (24%)
CG14500NP_611309.1 CLECT 31..166 CDD:214480 34/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.