DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CG14499

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001261072.3 Gene:CG14499 / 37086 FlyBaseID:FBgn0034317 Length:188 Species:Drosophila melanogaster


Alignment Length:137 Identity:33/137 - (24%)
Similarity:52/137 - (37%) Gaps:31/137 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NWFQAAGA---------------CRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDL 114
            |:.|.||.               |:.:||.|.|..:|.|..|:.:::... ...:...|.|||.|
  Fly    34 NFTQVAGKCLLFDNSWKNFLDRHCQSLNAGLLSFSNKMEFTAINEWLTTV-VPQSPELWTSGNKL 97

  Fly   115 GTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREM-----------INDANCKIQ 168
            |....:||.|.|:...|.||...:..|.    ..:|:.:.|...|           ::...|...
  Fly    98 GGSEDYYWQSTGKKAFYLPWQAGQPTPI----TGDCLTLLANVTMTAEGTTMSEHRLSVRGCTKW 158

  Fly   169 MLYVCEA 175
            ..:||:|
  Fly   159 APHVCQA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/134 (23%)
CG14499NP_001261072.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.