DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CG7763

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:133 Identity:35/133 - (26%)
Similarity:57/133 - (42%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNN----DYFW 108
            |.::|..|||||...|:||..|...|..|..||||::.:.|::.         |.|.    :.:|
  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDR---------FNNQLNGLNRYW 164

  Fly   109 ISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHM--FATREMINDANCKIQMLY 171
            |...:...|..|..::.|....:..|...:...|.     .||.:  |..:..:||.:|...:.:
  Fly   165 IDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG-----ECVDIRTFNGKTTMNDNSCFANLYF 224

  Fly   172 VCE 174
            :||
  Fly   225 ICE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/124 (25%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.