DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-32

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001023952.1 Gene:clec-32 / 3565962 WormBaseID:WBGene00009860 Length:365 Species:Caenorhabditis elegans


Alignment Length:203 Identity:43/203 - (21%)
Similarity:68/203 - (33%) Gaps:47/203 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRTETLLLILTSVGIPSLAYLPDVNIFTN-YRTEVYNGIPSEIDTTPFVRIGDNY-------YY 57
            :|.||    |:||...|:|.........|: ..|.:....||.|:|..|   |..|       .:
 Worm    62 VYETE----IVTSSTFPALPSTSSKADSTSASTTTLLTPAPSNINTCVF---GFTYINGKCWRLF 119

  Fly    58 IEPMNKVNWFQAAGACRMM-NAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFY 121
            .:|..:.|   |...|... .:.|.||.::.|..|:..::.....   ||||..           
 Worm   120 TDPQTREN---ADSVCMSYGGSTLFSIRNEQENNAIFDFVSNSSV---DYFWTG----------- 167

  Fly   122 WMSNGRPMTYAPWNGPKQMPDNYGGNEN---------CVHMFATREMI---NDANCKIQMLYVCE 174
            .:..|..::...|:......|.|....:         ||:...|....   ...:|...|.::||
 Worm   168 LICKGNTISSCIWDKESGSADGYDNFSDDYPDVAIGECVYFITTGSEAGKWKSGSCNPTMSFICE 232

  Fly   175 ATEPKTFK 182
            .  |.|.:
 Worm   233 L--PPTIQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 23/138 (17%)
clec-32NP_001023952.1 CLECT 104..232 CDD:214480 25/147 (17%)
CLECT 249..356 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.