DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CG11211

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:122 Identity:32/122 - (26%)
Similarity:61/122 - (50%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAK-GFKNNDYFWISGNDLGTEG 118
            |:.:....:|||.:|...|..:.|.||::.::.:.:.::.|:..| ....|..||:...:|....
  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRS 105

  Fly   119 AFY-WMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            .|: |||.|.|:|||.|:..:...|. .|.:.|: :..|..:.:...|:.:..::||
  Fly   106 YFWTWMSTGIPVTYAQWSRREPKSDR-TGQDACL-VLGTDNLWHSEPCQRKHNFICE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 30/120 (25%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49259
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.