DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Acp29AB

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:131 Identity:41/131 - (31%)
Similarity:65/131 - (49%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGN 112
            |.::|..:::||......||:|...||.||.|||:|:|:.|::.::...     .||.| ||..:
  Fly   114 FEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALA-----PNNSY-WIDIS 172

  Fly   113 DL-GTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCEAT 176
            .| ...|.|.....||...:..|   |...|....|: ||:::| :||..| .|..:..:||:|.
  Fly   173 KLVENGGTFVSTLTGREPFFVKW---KSNQDTKKKNQ-CVYIYA-KEMSYD-ECFEKKSFVCQAD 231

  Fly   177 E 177
            :
  Fly   232 Q 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 37/119 (31%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.