DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and lectin-37Db

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:147 Identity:40/147 - (27%)
Similarity:74/147 - (50%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YNGIPSEIDTTPF-----VRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKY 95
            ::.:|  ::::|.     :.||:..|||. :.|.|||:|:..||.....|.::|.:.|:|.|..:
  Fly    13 WSALP--LESSPLGNRYNLEIGEKQYYIS-LAKTNWFEASNHCRQNGGFLLNLESREELELLSPH 74

  Fly    96 MKAKGFKNNDY-FWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMF--ATR 157
            :      :..| :|:|.||||..|.:...:.|....:..|:..:  |||..|.:.||.::  .|.
  Fly    75 L------HPAYSYWLSINDLGERGVYVSEATGLEAPFLNWSAGE--PDNSSGYDRCVELWLSTTS 131

  Fly   158 EMINDANCKIQMLYVCE 174
            ..:||..|...:.::|:
  Fly   132 FQMNDLPCYSSVAFICQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/121 (29%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 35/122 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.