DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CD209

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:126 Identity:31/126 - (24%)
Similarity:59/126 - (46%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEG 118
            |.|::....: ||..:..||:.:.|.|..|:...|.    .:::.:..::|.:.|:..:||..||
Human   266 NCYFMSNSQR-NWHDSITACKEVGAQLVVIKSAEEQ----NFLQLQSSRSNRFTWMGLSDLNQEG 325

  Fly   119 AFYWMSNGRPMTYAP-----WNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            .:.|: :|.|:  .|     ||  :..|:|. |.|:|...  :....||..|.:...::|:
Human   326 TWQWV-DGSPL--LPSFKQYWN--RGEPNNV-GEEDCAEF--SGNGWNDDKCNLAKFWICK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 29/123 (24%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
PilO 38..>184 CDD:294757
neck domain 60..249
CLECT_DC-SIGN_like 256..379 CDD:153060 31/126 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.