DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Asgr2

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_058885.1 Gene:Asgr2 / 29403 RGDID:2161 Length:301 Species:Rattus norvegicus


Alignment Length:156 Identity:39/156 - (25%)
Similarity:67/156 - (42%) Gaps:30/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGF 101
            ||  :|.....:|..|.:.|:.. .:.:.|.:|...|:|.||||..|..:.|.|.::|:..|   
  Rat   165 NG--TECCPVNWVEFGGSCYWFS-RDGLTWAEADQYCQMENAHLLVINSREEQEFVVKHRGA--- 223

  Fly   102 KNNDYFWISGNDLGTEGAFYWM------SNGRPMTYAPWNGPKQMPDNY-----GGNENCVHMFA 155
               .:.||...|  .:|::.|:      ||.:...:.       .|||:     ||:|:|..:.:
  Rat   224 ---FHIWIGLTD--KDGSWKWVDGTEYRSNFKNWAFT-------QPDNWQGHEEGGSEDCAEILS 276

  Fly   156 TREMINDANCKIQMLYVCEATEPKTF 181
            . .:.||..|:....:.||.....|:
  Rat   277 D-GLWNDNFCQQVNRWACERKRDITY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/129 (24%)
Asgr2NP_058885.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Lectin_N 29..162 CDD:397859
CLECT_DC-SIGN_like 170..295 CDD:153060 34/141 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.